PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010111100.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Moraceae; Morus
Family G2-like
Protein Properties Length: 335aa    MW: 35229.1 Da    PI: 7.1503
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010111100.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like96.52e-30113166155
         G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                     +prl+Wtp+LH+rFv+av++L G+++A+Pkti++lm+v+gLt+e+v+SHLQkYRl
  XP_010111100.1 113 RPRLVWTPQLHKRFVDAVAHL-GIKNAVPKTIMQLMSVDGLTRENVASHLQKYRL 166
                     59*******************.********************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.059110169IPR017930Myb domain
SuperFamilySSF466893.4E-20110170IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.4E-30112171IPR009057Homeodomain-like
TIGRFAMsTIGR015573.8E-24114166IPR006447Myb domain, plants
PfamPF002491.3E-7116165IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 335 aa     Download sequence    Send to blast
MREDDSNWFA RWEEELPSPE ELMPLSQTLI TPDLAMAFDI RNPNSNSNNN NNNTSPPRGP  60
AQAHQQHPPP PSSSPLQPPS SVTAQPNSSD FGDSADLGSG GGPGEEPART LKRPRLVWTP  120
QLHKRFVDAV AHLGIKNAVP KTIMQLMSVD GLTRENVASH LQKYRLYLKR MQGLSGGGGG  180
GGAGGAGAAG LGGGADPATD HLFASSPVPA HFLHPAAAAA GRPNSEHFLP YVPVAALQHH  240
HHHQQHMAAA VAAAGGHPQI QGQYHHRQVA HFGSPPAAVA AANGQFEHPF LGRQGQAVHR  300
MGAPVHNGYV EDLESGNGAA GGGRKVLTLF PTGED
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A6e-21112171463ARR10-B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150413e-49AP015041.1 Vigna angularis var. angularis DNA, chromosome 8, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010111100.10.0Two-component response regulator
SwissprotQ9SNB43e-50PCL1_ARATH; Transcription factor LUX
TrEMBLW9S6Z70.0W9S6Z7_9R
STRINGVIT_08s0040g00900.t011e-117(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF85423045
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G10760.13e-86G2-like family protein